Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ALS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALS2 antibody: synthetic peptide directed towards the middle region of human ALS2. Synthetic peptide located within the following region: ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSG

ALS2 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human ALS2

ALS2 (C-term) goat polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Goat Anti-Alsin / ALS2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence LKACYYQIQREKLN, from the C Terminus of the protein sequence according to NP_065970.2.

Anti-ALS2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human amyotrophic lateral sclerosis 2 (juvenile)