Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Rabbit Polyclonal Glutathione Peroxidase 3 Antibody

Applications WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
Immunogen Full length human GPX3 protein [Swiss-Prot# P22352] expressed in E. coli.