Rabbit Polyclonal Anti-ADC Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADC antibody: synthetic peptide directed towards the middle region of human ADC. Synthetic peptide located within the following region: RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH |
Rabbit Polyclonal Anti-ADC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADC antibody is: synthetic peptide directed towards the C-terminal region of Human ADC. Synthetic peptide located within the following region: AELGRYYVTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGV |
Germany
Japan
United Kingdom
China
