Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI

Rabbit polyclonal anti-CACNG1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CACNG1.