Rabbit Polyclonal Anti-TAF6L Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF6L Antibody: A synthesized peptide derived from human TAF6L |
Rabbit Polyclonal Anti-TAF6L Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF6L Antibody: A synthesized peptide derived from human TAF6L |
Rabbit polyclonal anti-TAF6L antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF6L. |
Rabbit Polyclonal Anti-TAF6L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF6L antibody: synthetic peptide directed towards the N terminal of human TAF6L. Synthetic peptide located within the following region: MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQN |
Rabbit Polyclonal Anti-TAF6L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF6L antibody: synthetic peptide directed towards the N terminal of human TAF6L. Synthetic peptide located within the following region: MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQN |
Rabbit Polyclonal Anti-TAF6L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAF6L antibody is: synthetic peptide directed towards the C-terminal region of Human TAF6L. Synthetic peptide located within the following region: GRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLY |