Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TBPL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBPL1 antibody: synthetic peptide directed towards the middle region of human TBPL1. Synthetic peptide located within the following region: LQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPA

Goat Polyclonal Antibody against TBPL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QIYPFVFESRKEIL, from the C Terminus of the protein sequence according to NP_004856.