Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-BUB3 Antibody - N-terminal region

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3. Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR

Rabbit Polyclonal Bub3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bub3 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human bub3.

Rabbit polyclonal anti-BUB3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human BUB3.
Modifications Phospho-specific

Rabbit Polyclonal Anti-BUB3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BUB3