Primary Antibodies

Jump to Filters
View as table Download
ORC4L (ORC4) Rabbit Polyclonal Antibody
TA344603

USD 475.00

5 Days

Rabbit Polyclonal Anti-ORC4L Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORC4L antibody: synthetic peptide directed towards the middle region of human ORC4L. Synthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV
ORC4L (ORC4) Goat Polyclonal Antibody
TA302715

USD 375.00

5 Days

Goat Polyclonal Antibody against ORC4L

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DVRQWATSSLSWL, from the C Terminus of the protein sequence according to NP_002543.