Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HCK Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HCK

Rabbit polyclonal HCK Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-156 amino acids from the N-terminal region of human HCK.

Rabbit Polyclonal Anti-HCK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HCK antibody is: synthetic peptide directed towards the C-terminal region of Human HCK. Synthetic peptide located within the following region: LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA

Rabbit polyclonal HCK (Tyr521) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human HCK around the phosphorylation site of tyrosine 521.
Modifications Phospho-specific