Rabbit polyclonal CSGALNACT1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT1. |
Rabbit polyclonal CSGALNACT1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT1. |
Rabbit Polyclonal Anti-CSGALNACT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSGALNACT1 antibody: synthetic peptide directed towards the N terminal of human CSGALNACT1. Synthetic peptide located within the following region: KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE |
Rabbit Polyclonal Anti-ChGn Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ChGn antibody: synthetic peptide directed towards the C terminal of human ChGn. Synthetic peptide located within the following region: DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT |