Primary Antibodies

View as table Download

Rabbit Polyclonal IL-9 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-9 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-9.

Anti-Human IL-9 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-9

Rabbit polyclonal anti-IL-9 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein.

Rabbit polyclonal IL-9 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein.

Biotinylated Anti-Human IL-9 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-9

Rabbit Polyclonal Anti-IL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL9 Antibody: synthetic peptide directed towards the middle region of human IL9. Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT