Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RAB5C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5C antibody: synthetic peptide directed towards the middle region of human RAB5C. Synthetic peptide located within the following region: KTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS

USD 320.00

In Stock

Goat Polyclonal Anti-Rab5c Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 118 aa to the C-terminus of mouse Rab5c produced in E. coli.

Anti-RAB5C Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-17 amino acids of Human Ras-related protein Rab-5C

Rabbit polyclonal anti-RAB5C antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAB5C.

Anti-RAB5C Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-17 amino acids of Human Ras-related protein Rab-5C