Primary Antibodies

View as table Download

SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-SOS1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sos1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Sos1. Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE