Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-AGPAT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGPAT3 antibody: synthetic peptide directed towards the middle region of human AGPAT3. Synthetic peptide located within the following region: KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA

Rabbit polyclonal anti-AGPAT3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AGPAT3.