Rabbit polyclonal anti-NDUFB10 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFB10. |
Rabbit polyclonal anti-NDUFB10 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFB10. |
NDUFB10 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Rabbit polyclonal NDUFB10 Antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NDUFB10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-70 amino acids from the Central region of human NDUFB10. |
Rabbit Polyclonal Anti-NDUFB10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDUFB10 antibody is: synthetic peptide directed towards the C-terminal region of NDUFB10. Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody,clone OTI2B4
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody,clone OTI4D1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFB10 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NDUFB10 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 1H6, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 1H6, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NDUFB10 mouse monoclonal antibody,clone OTI2B4
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 2B4, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 2B4, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody,clone OTI2B4
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NDUFB10 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 2G1, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 2G1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NDUFB10 mouse monoclonal antibody,clone OTI4D1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 4D1, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 4D1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody,clone OTI4D1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NDUFB10 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 2H10, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 2H10, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NDUFB10 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 5C12, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 5C12, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NDUFB10 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
NDUFB10 mouse monoclonal antibody,clone 4F1, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NDUFB10 mouse monoclonal antibody,clone 4F1, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NDUFB10 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".