Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ITPK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITPK1 Antibody: A synthesized peptide derived from human ITPK1 |
Primary Antibodies
View as table Download
Rabbit polyclonal anti-ITPK1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ITPK1. |
Rabbit Polyclonal Anti-ITPK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the N terminal of human ITPK1. Synthetic peptide located within the following region: MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI |
USD 420.00
4 Weeks
ITPK1 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- ITPK1
Pathways
- Inositol phosphate metabolism