Primary Antibodies

Jump to Filters
View as table Download
SHC3 Rabbit Polyclonal Antibody
TA345003

USD 475.00

5 Days

Rabbit Polyclonal Anti-SHC3 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Shc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS
SHC3 Rabbit Polyclonal Antibody
TA326108

USD 345.00

In Stock

Rabbit polyclonal SHC3 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SHC3.