Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CHST6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: YAFTGLSLTPQLEAWIHNITHGSGPGARREAFKTSSRNALNVSQAWRHAL

Rabbit Polyclonal Anti-CHST6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN

Rabbit polyclonal anti-CHST6 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHST6.

CHST6 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 303-333 amino acids from the C-terminal region of human CHST6

Carrier-free (BSA/glycerol-free) CHST6 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

CHST6 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

CHST6 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated