Primary Antibodies

View as table Download

Clathrin light chain (CLTB) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Recombinant protein from human CLTB

Rabbit Polyclonal Anti-CLTB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLTB antibody: synthetic peptide directed towards the C terminal of human CLTB. Synthetic peptide located within the following region: ADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLR