Primary Antibodies

Jump to Filters
View as table Download
AP1M2 Rabbit Polyclonal Antibody
TA340065

USD 375.00

5 Days

Rabbit Polyclonal Anti-AP1M2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP1M2 antibody: synthetic peptide directed towards the N terminal of human AP1M2. Synthetic peptide located within the following region: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL