Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CTSC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSC antibody is: synthetic peptide directed towards the N-terminal region of Human CTSC. Synthetic peptide located within the following region: VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD

Rabbit polyclonal Dipeptidyl-peptidase 1 (heavy chain, Cleaved-Arg394) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Dipeptidyl-peptidase 1.

Rabbit Polyclonal Anti-CTSC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSC antibody: synthetic peptide directed towards the middle region of human CTSC. Synthetic peptide located within the following region: WTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTS

Rabbit Polyclonal Anti-CTSC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CTSC