Primary Antibodies

Jump to Filters
View as table Download
FGF16 Goat Polyclonal Antibody
TA328314

USD 285.00

5 Days

Anti-Human FGF-16 Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human FGF-16
FGF16 Rabbit Polyclonal Antibody
TA338201

USD 375.00

5 Days

Rabbit Polyclonal Anti-FGF16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF16 antibody is: synthetic peptide directed towards the C-terminal region of Human FGF16. Synthetic peptide located within the following region: REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH
FGF16 Rabbit Polyclonal Antibody
TA351187

USD 345.00

In Stock

Rabbit Polyclonal Anti-FGF16 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF16