Primary Antibodies

View as table Download

Goat Anti-Fgf14 (mouse N terminus) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence REQHWDRPSASR-C, from the N Terminus of the protein sequence according to NP_034331.2; NP_997550.1.

Rabbit Polyclonal Anti-FGF14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF14 antibody: synthetic peptide directed towards the middle region of human FGF14. Synthetic peptide located within the following region: ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP