Primary Antibodies

View as table Download

MCP-2 / CCL8 Mouse Monoclonal Antibody

Applications IHC
Reactivities Human

Anti-Human MCP-2 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MCP-2 (CCL8)

Biotinylated Anti-Human MCP-2 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MCP-2 (CCL8)

Rabbit Polyclonal Anti-CCL8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL8 antibody: synthetic peptide directed towards the middle region of human CCL8. Synthetic peptide located within the following region: SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP