Primary Antibodies

View as table Download

Lunatic Fringe (LFNG) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 93~122 amino acids from the Central region of human LFNG

Rabbit polyclonal anti-LFNG antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human LFNG.

Rabbit Polyclonal Anti-LFNG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LFNG Antibody: synthetic peptide directed towards the N terminal of human LFNG. Synthetic peptide located within the following region: LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK