Primary Antibodies

Jump to Filters
View as table Download
XPD (ERCC2) Rabbit Polyclonal Antibody
TA590019

USD 409.00

In Stock

Rabbit Polyclonal XPD Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
XPD (ERCC2) Rabbit Polyclonal Antibody
TA330046

USD 375.00

5 Days

Rabbit Polyclonal Anti-ERCC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS
XPD (ERCC2) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
CF804192

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
XPD (ERCC2) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
TA804192

USD 379.00

In Stock

ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
XPD (ERCC2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B11]
TA804192BM

USD 420.00

4 Weeks

ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
XPD (ERCC2) Mouse Monoclonal Antibody [Clone ID: OTI4B11]
TA804192S

USD 159.00

2 Days

ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated