Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-OR2T12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2T12 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2T12. Synthetic peptide located within the following region: VVSAFYTMFTPLLNPLIYSVRNSEVKEALKRWLGTCVNLKHQQNEAHRSR

Rabbit Polyclonal Anti-OR2T12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2T12 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2T12. Synthetic peptide located within the following region: GIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVRNSEVKEALKRW