Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-OR2W1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2W1 antibody: synthetic peptide directed towards the C terminal of human OR2W1. Synthetic peptide located within the following region: VVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKD

OR2W1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated