Primary Antibodies

View as table Download

Rabbit polyclonal anti-OR52E2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR52E2.

Rabbit Polyclonal Anti-OR52E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52E2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR52E2. Synthetic peptide located within the following region: RYIHILLANLYVVVPPMLNPVIYGVRTKQIYKCVKKILLQEQGMEKEEYL