Primary Antibodies

View as table Download

Rabbit polyclonal anti-OR56A3 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR56A3.

Rabbit Polyclonal Anti-OR56A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR56A3 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR56A3. Synthetic peptide located within the following region: RAVLRLKAEGAVAKALSTCGSHFMLILFFSTILLVFVLTHVAKKKVSPDV