Primary Antibodies

View as table Download

Rabbit polyclonal anti-OR51B2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR51B2.

Rabbit Polyclonal Anti-OR51B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR51B2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51B2. Synthetic peptide located within the following region: YRFGKNVPEVVHIIMSYIYFLFPSLMNPVIYSIKTKQIQYGIIRLLSKHR