Primary Antibodies

View as table Download

Rabbit polyclonal anti-OR52A1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR52A1.

OR52A1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 255-284 amino acids from the C-terminal region of human Olfactory receptor 52A1

Rabbit Polyclonal Anti-OR52A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR52A1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR52A1. Synthetic peptide located within the following region: IQIFITVFRLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHI