Primary Antibodies

Jump to Filters
View as table Download
liver FABP (FABP1) Rabbit Polyclonal Antibody
TA332603

USD 275.00

3 Weeks

Rabbit anti-FABP1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FABP1
liver FABP (FABP1) Rabbit Polyclonal Antibody
TA319093

USD 355.00

3 Weeks

Rabbit polyclonal anti-FABP3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human FABP3
liver FABP (FABP1) Rabbit Polyclonal Antibody
TA342386

USD 375.00

5 Days

Rabbit Polyclonal Anti-FABP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP1 antibody: synthetic peptide directed towards the N terminal of human FABP1. Synthetic peptide located within the following region: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF
liver FABP (FABP1) Rabbit Polyclonal Antibody
TA351300

USD 345.00

In Stock

Rabbit Polyclonal Anti-FABP1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FABP1