Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RAD51 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS

Rabbit polyclonal RAD51 (Ab-315) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human RAD51 around the phosphorylation site of tyrosine 315 (K-I-YP-D-S).

Rabbit polyclonal RAD51 (Tyr315) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RAD51 around the phosphorylation site of tyrosine 315 (K-I-YP-D-S).
Modifications Phospho-specific

Mouse Monoclonal Rad51 Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Anti-RAD51 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 301-312 amino acids of Human RAD51 homolog (S. cerevisiae)

Rabbit Polyclonal Anti-RAD51 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAD51

Rabbit Polyclonal anti-RAD51 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAD51

Rabbit Polyclonal anti-RAD51 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAD51

Special Offer: Get this product for $99/€99. Use code: "Truesample".