Primary Antibodies

View as table Download

Rabbit polyclonal Cytochrome c-type Heme Lyase antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CCHL.

HCCS (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 179~209 amino acids from the Central region of human HCCS / CCHL

Rabbit Polyclonal Anti-HCCS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HCCS antibody: synthetic peptide directed towards the C terminal of human HCCS. Synthetic peptide located within the following region: PRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTIL

HCCS Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated