Primary Antibodies

View as table Download

Rabbit polyclonal anti-RPL18 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL18.

Rabbit polyclonal Anti-RPL18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL18 antibody: synthetic peptide directed towards the N terminal of human RPL18. Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR