Primary Antibodies

Jump to Filters
View as table Download
Laminin (LAMC3) Rabbit Polyclonal Antibody
TA315044

USD 345.00

In Stock

Rabbit polyclonal anti-LAMC3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMC3.
Laminin (LAMC3) Rabbit Polyclonal Antibody
TA338136

USD 375.00

5 Days

Rabbit Polyclonal Anti-LAMC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMC3 antibody is: synthetic peptide directed towards the C-terminal region of Human LAMC3. Synthetic peptide located within the following region: ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLT