Primary Antibodies

Jump to Filters
View as table Download
DHX8 Rabbit Polyclonal Antibody
TA313749

USD 345.00

In Stock

Rabbit polyclonal anti-DHX8 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DHX8.
DHX8 Rabbit Polyclonal Antibody
TA341575

USD 375.00

5 Days

Rabbit Polyclonal Anti-DHX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHX8 antibody: synthetic peptide directed towards the N terminal of human DHX8. Synthetic peptide located within the following region: VKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP