Primary Antibodies

View as table Download

Rabbit polyclonal Anti-PGM2L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGM2L1 antibody: synthetic peptide directed towards the N terminal of human PGM2L1. Synthetic peptide located within the following region: KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK

Carrier-free (BSA/glycerol-free) PGM2L1 mouse monoclonal antibody,clone OTI1C2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGM2L1 mouse monoclonal antibody,clone OTI2D12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGM2L1 mouse monoclonal antibody,clone OTI4G6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PGM2L1 mouse monoclonal antibody,clone OTI5F5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PGM2L1 mouse monoclonal antibody,clone OTI1C2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PGM2L1 mouse monoclonal antibody,clone OTI1C2, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PGM2L1 mouse monoclonal antibody,clone OTI1C2, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PGM2L1 mouse monoclonal antibody,clone OTI2D12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PGM2L1 mouse monoclonal antibody,clone OTI4G6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PGM2L1 mouse monoclonal antibody,clone OTI4G6, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PGM2L1 mouse monoclonal antibody,clone OTI4G6, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PGM2L1 mouse monoclonal antibody,clone OTI5F5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated