Rabbit polyclonal antibody to BAT (bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase))
| Reactivities | Human |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 139 and 415 of BAAT (Uniprot ID#Q14032) |
Rabbit Polyclonal Anti-BAAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BAAT antibody: synthetic peptide directed towards the N terminal of human BAAT. Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR |
Rabbit Polyclonal Anti-BAAT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BAAT |
Germany
Japan
United Kingdom
China