Primary Antibodies

Jump to Filters
View as table Download
ACADS (1-104) Rabbit Polyclonal Antibody
AP23097PU-N

USD 440.00

2 Weeks

ACADS (1-104) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 104 of Human SCAD
ACADS Rabbit Polyclonal Antibody
TA336254

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACADS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACADS Antibody: synthetic peptide directed towards the N terminal of human ACADS. Synthetic peptide located within the following region: ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGN
ACADS Rabbit Polyclonal Antibody
TA336255

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACADS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACADS Antibody: synthetic peptide directed towards the middle region of human ACADS. Synthetic peptide located within the following region: FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA
ACADS Mouse Monoclonal Antibody [Clone ID: OTI1D2]
CF800429

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACADS mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
ACADS Rabbit Polyclonal Antibody
TA321035

USD 345.00

In Stock

Anti-ACADS rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase, C-2 to C-3 short chain
ACADS Rabbit Polyclonal Antibody
TA321036

USD 345.00

4 Weeks

Anti-ACADS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase, C-2 to C-3 short chain
ACADS Mouse Monoclonal Antibody [Clone ID: OTI1D2]
TA800429

USD 379.00

In Stock

ACADS mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
ACADS Mouse Monoclonal Antibody [Clone ID: OTI1D2]
TA800429S

USD 159.00

2 Days

ACADS mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated