Goat Anti-NDUFS3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DTRPTVRPRNDVAHK, from the internal region of the protein sequence according to NP_004542.1. |
Goat Anti-NDUFS3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DTRPTVRPRNDVAHK, from the internal region of the protein sequence according to NP_004542.1. |
Rabbit polyclonal Anti-NDUFS3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ |
Rabbit polyclonal Anti-NDUFS3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK |
Rabbit Polyclonal Anti-NDUFS3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NDUFS3 |
NDUFS3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NDUFS3 |
NDUFS3 Rabbit polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 37-264 of human NDUFS3 (NP_004542.1). |
Modifications | Unmodified |