Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ATP1B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP1B4 antibody: synthetic peptide directed towards the middle region of human ATP1B4. Synthetic peptide located within the following region: ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS

ATP1B4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATP1B4