Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ATP4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP4B antibody: synthetic peptide directed towards the middle region of human ATP4B. Synthetic peptide located within the following region: QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK

ATP4B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 62-291 of human ATP4B (NP_000696.1).
Modifications Unmodified