Rabbit polyclonal anti-BLMH antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This BLMH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 212-242 amino acids from the Central region of human BLMH. |
Rabbit polyclonal Anti-BLMH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLMH antibody: synthetic peptide directed towards the middle region of human BLMH. Synthetic peptide located within the following region: EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL |
BLMH Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human BLMH (NP_000377.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China