Rabbit Polyclonal Anti-C4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM |
Carrier-free (BSA/glycerol-free) C4B mouse monoclonal antibody,clone OTI1B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C4B mouse monoclonal antibody,clone OTI1B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C4B mouse monoclonal antibody,clone OTI1B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China