Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DGKD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKD Antibody: A synthesized peptide derived from human DGKD

Rabbit polyclonal anti-DGKD antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKD.

Rabbit Polyclonal Anti-DGKD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKD antibody is: synthetic peptide directed towards the C-terminal region of Human DGKD. Synthetic peptide located within the following region: KRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSL

DGKD rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DGKD

DGKD Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 960-1140 of human DGKD (NP_690618.2).
Modifications Unmodified