Primary Antibodies

View as table Download

DPP2 / DPP7 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Orang-Utan, Gorilla
Conjugation Unconjugated
Immunogen DPP2 / DPP7 antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human DPP7 / DPP2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Marmoset (100%); Gibbon (94%).

Rabbit Polyclonal Anti-DPP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPP7 antibody is: synthetic peptide directed towards the middle region of Human DPP7. Synthetic peptide located within the following region: FRQIKDLFLQGAYDTVRWEFGTCQPLSDEKDLTQLFMFARNAFTVLAMMD