Primary Antibodies

View as table Download

FBXW8 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FBXW8

Rabbit polyclonal Anti-FBXW8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXW8 antibody: synthetic peptide directed towards the middle region of human FBXW8. Synthetic peptide located within the following region: MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR

Rabbit polyclonal Anti-FBXW8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXW8 antibody: synthetic peptide directed towards the middle region of human FBXW8. Synthetic peptide located within the following region: RNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYD

FBXW8 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FBXW8

FBXW8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FBXW8.