Primary Antibodies

View as table Download

FGF13 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF13

FGF13 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF13

Rabbit polyclonal anti-FGF13 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FGF13.

Rabbit Polyclonal Anti-FGF13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FGF13 Antibody: synthetic peptide directed towards the middle region of human FGF13. Synthetic peptide located within the following region: PKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST

Goat Anti-FGF13 (isoform 1) Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence KGKTSCDKNKLNVFS, from the internal region of the protein sequence according to NP_004105.1.

Rabbit Polyclonal Anti-FGF13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FGF13 Antibody: synthetic peptide directed towards the middle region of human FGF13. Synthetic peptide located within the following region: TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK

Carrier-free (BSA/glycerol-free) FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FGF13 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF13

FGF13 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF13

FGF13 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human FGF13 (NP_004105.1).
Modifications Unmodified

FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FGF13 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

FGF13 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated